| Site home page | Conference home page | Discussion |
Gabriele Klosner, Roland Varecka,* and Franz Trautinger
Division of Special and Environmental Dermatology, Dept.Dermatol.,
Univ.Vienna; *Boehringer-Ingelheim Austria GmbH;Vienna, Austria
INTRODUCTION
Protein tyrosine kinases (PTKs) play a significant role in signalling pathways that regulate cell proliferation, differentiation, transformation and immune responses.
After exposure to stress PTKs have been described to be involved in the induction of growth arrest and apoptosis. Exposure of human skin to UV induces major changes in the genetic program of the exposed cells leading to immediate and long term skin changes.
Although it can be assumed that UV-induced modifications of signal transduction involving PTKs regulate these processes, details as to the specific changes in PTK expression after UV exposure are unknown.
METHODS
To investigate PTK expression in normal human keratinocytes (HNK) we employed a reversed transcriptase-PCR approach using degenerate primers derived from the conserved catalytic domain of PTKs (table 1).
PCR products were cloned and PTKs from randomly picked colonies (up to n = 87 per screen) were identified by sequence analysis. PTK profiles of sham-irradiated, UVA (filtered metal halide lamp, 60 J/cm²), and UVB (filtered metal halide lamp, 256 mJ/cm²) treated HNK were analyzed 7 h after exposure.
Results were analyzed by chi-square test for statistical significance.
RESULTS
We identified 14 PTKs including 3 receptor kinases (axl, cak, fgfr2) and 11 non-receptor kinases (abl1, abl2, lck, map4k2, fyn, yes, src, cnk, ptk6, mstr1, jak1). The PTK profile of HNK was characterized by a predominance of abl2.
Differential screening revealed a further induction of abl2 expression by UVA. UVB had no influence on abl2 but predominantly induced the expression of the receptor kinases of the axl-family. Both treatments lead to a downregulation of src-family kinases (src, fyn, yes) (table 2, table 3).
Overall evaluation revealed that the effect of UVA and UVB on receptor vs. non-receptor kinases is reciprocal: UVA stimulates expression of non-receptor kinases and inhibits receptor PTKs, while UVB had the opposite effect (table 2, table 3).
The differences reached statistical significance at p<0.0001.
DISCUSSION
These results for the first time provide information on the PTK expression profile of HNK and its modification by UV.
The observed UV effects are wavelength dependent and affect PTKs which are involved in the regulation of gene transcription, cell death, and proliferation.
We conclude that regulation of PTK expression is part of genetic program
that mediates late effects of UVA and UVB through specific alterations
in phosphorylation dependent signalling cascades.
Table 1: Primer strategy and kinase domains of PTKs amplified from HNK. Conserved amino acids are indicated in bold letters.
Degenerate primers used for amplification of PTKs
5’ primer
Protein K
(V/I) (A/S/T) D
F G
DNA AA(A/G) (A/G)TN
(A/G/T)CN GA(T/C) TT(T/C) GG
3’ primer
Protein G
(F/Y) (S/A) W V
D
DNA NCC (A/C)(A/T)A NG(A/C)
CCA NAC AG(T/C)
Receptor TK
name
dfg msrnlyagdyyrvqgravlpirwmawecilmgkfttas
dvw cak
dfg lardinnidyykkttngrlpvkwmapealfdrvythqs
dvw fgfr2
dfg lsrkiysgdyyrqgcasklpvkwlalesladnlytvhs
dvw tyro3
Non-Receptor TK
dfg lsrlmtgdtytahagakfpikwtapeslaynkfsiks
dvw abl1
dfg lsrlmtgdtytahagakfpikwtapeslayntfsiks
dvw abl2
dfgltkaietdkeyytvkddrdspvfwyapeclmqskfyias
dvw jak1
dfg larliedneytaregakfpikwtapeainygtftiks
dvw lck
dfg vsgeltasvakrrsfigtpywmapevaaverkggynelcdvw
map4k2
dfg larlikedvylshdhnipykwtapealsrghystks
dvw ptk6
dfg larliedneytarqgakfpikwtapeaalygrftiks
dvw src
dfg larliedneytarqgakfpikwtapeaalygrftiks
dvw yes
dfg larliedneytarqgakfpikwtapeaalygrftiks
dvw fyn
dfg laarleppeqrkkticgtpnyvapevllrqghgpea
dvw cnk
Table 2: Frequency of PTKs in untreated HNK
and after exposure to UVA and UVB. 14 individual kinases could be identified;
numbers denote their absolute frequency in a randomly picked sample of
clones.
|
|
|
|
|
| cak* |
|
|
|
| fgfr2* |
|
|
|
| tyro3/axl* |
|
|
|
| abl1 |
|
|
|
| abl2 |
|
|
|
| cnk |
|
|
|
| fyn |
|
|
|
| jak1 |
|
|
|
| lck |
|
|
|
| map4k2 |
|
|
|
| mstr1 |
|
|
|
| ptk6 |
|
|
|
| src |
|
|
|
| yes |
|
|
|
| total |
|
|
|
* receptor tyrosine kinase
|
|
|
|
|
| receptor
tyrosine kinase |
|
|
|
| non-receptor
tyrosine kinase |
|
|
|
| total |
|
|
|
Table 3: Relative frequency of PTKs in untreated
HNK and after exposure to UVA and UVB. Numbers denote the percentage
of each individual kinase calculated from table 1.
|
|
|
|
|
| cak* |
|
|
|
| fgfr2* |
|
|
|
| tyro3/axl* |
|
|
|
| abl1 |
|
|
|
| abl2 |
|
|
|
| cnk |
|
|
|
| fyn |
|
|
|
| jak1 |
|
|
|
| lck |
|
|
|
| map4k2 |
|
|
|
| mstr1 |
|
|
|
| ptk6 |
|
|
|
| src |
|
|
|
| yes |
|
|
|
* receptor tyrosine kinase
|
|
|
|
|
| receptor
tyrosine kinase |
|
|
|
| non-receptor
tyrosine kinase |
|
|
|